PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G109800.1
Common NamePHAVU_005G109800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 228aa    MW: 26232.3 Da    PI: 5.2174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G109800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT eEd++l+ +v+++G  +W++ ++  g+ R++k+c++rw++yl
  Phvul.005G109800.1 14 KGSWTREEDKKLIAYVTKYGHWNWRLLPKFAGLARCGKSCRLRWLNYL 61
                        799*****************99************************97 PP

2Myb_DNA-binding635.9e-2067112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++ eE+e++v+++++lG++ W+tIa++++ gRt++++k++w+++l
  Phvul.005G109800.1  67 RGNFSDEEEEIIVRLHEKLGNR-WSTIAAELP-GRTDNEIKNHWHTVL 112
                         89********************.*********.***********9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.166961IPR017930Myb domain
SuperFamilySSF466898.24E-3011108IPR009057Homeodomain-like
SMARTSM007172.5E-111363IPR001005SANT/Myb domain
PfamPF002492.6E-141461IPR001005SANT/Myb domain
CDDcd001671.01E-91661No hitNo description
PROSITE profilePS5129427.32362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2665115IPR009057Homeodomain-like
SMARTSM007172.6E-1866114IPR001005SANT/Myb domain
PfamPF002493.0E-1767112IPR001005SANT/Myb domain
CDDcd001677.93E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MARTPCCDKN GLKKGSWTRE EDKKLIAYVT KYGHWNWRLL PKFAGLARCG KSCRLRWLNY  60
LRPDVKRGNF SDEEEEIIVR LHEKLGNRWS TIAAELPGRT DNEIKNHWHT VLKKRFEQKA  120
EAKSGIGKES SISRSFETVS ENYSDPDATN ASPVAPAAAT NHESDDGLSF FDAYSEPVSA  180
DFWTEPYLID NSYVPPEFEP VYFSPMYDVE LWNQNEMYLQ ECEGLFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150402e-52AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149916.11e-171hypothetical protein PHAVU_005G109800g
SwissprotQ7XBH42e-62MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLV7BXY51e-171V7BXY5_PHAVU; Uncharacterized protein
STRINGGLYMA13G37903.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-61myb domain protein 14